PDB entry 2zhj

View 2zhj on RCSB PDB site
Description: Crystal Structure Analysis of the Sodium-Bound Annexin A4 at 1.34 A resolution
Class: metal binding protein
Keywords: zynogen granule, membrane binding protein, metal binding protein, Annexin, Calcium, Calcium/phospholipid-binding
Deposited on 2008-02-06, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.153
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Annexin A4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Anxa4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zhja_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zhjA (A:)
    gipmetkggtvkaasgfnatedaqvlrkamkglgtdedaiigvlacrntaqrqeirtayk
    stigrdlledlkselssnfeqvilgmmtptvlydvqelrramkgagtdegclieilasrn
    peeirrinqtyqqqygrsleedicsdtsfmfqrvlvsltaggrdegnylddalvkqdaqd
    lyeagekrwgtdevkflsilcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedall
    aivkcmrnkpayfaerlyksmkglgtddstlirvmvsraeidmldiranfkrlygkslys
    fikgdtsgdyrkvllilcggdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zhjA (A:)
    etkggtvkaasgfnatedaqvlrkamkglgtdedaiigvlacrntaqrqeirtaykstig
    rdlledlkselssnfeqvilgmmtptvlydvqelrramkgagtdegclieilasrnpeei
    rrinqtyqqqygrsleedicsdtsfmfqrvlvsltaggrdegnylddalvkqdaqdlyea
    gekrwgtdevkflsilcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedallaivk
    cmrnkpayfaerlyksmkglgtddstlirvmvsraeidmldiranfkrlygkslysfikg
    dtsgdyrkvllilcg