PDB entry 2zgv

View 2zgv on RCSB PDB site
Description: Crystal Structure of human phosphoglycerate kinase bound to D-ADP
Class: Transferase
Keywords: PROTEIN-NUCLEOTIDE COMPLEX, Acetylation, ATP-binding, Cytoplasm, Disease mutation, Glycolysis, Hereditary hemolytic anemia, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase
Deposited on 2008-01-26, released 2008-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: HOMO SAPIENS
    Gene: PGK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zgva_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zgvA (A:)
    gshmslsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaks
    vvlmshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvi
    llenlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmv
    gvnlpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiig
    ggmaftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenak
    tgqatvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmd
    evvkatsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zgvA (A:)
    lsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlp
    qkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaf
    tflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqat
    vasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvka
    tsrgcitiiggedkvshvstgggaslellegkvlpgvdalsni