PDB entry 2zgq

View 2zgq on RCSB PDB site
Description: Crystal structure of AAL mutant L33A in P1 spacegroup
Class: Hydrolase
Keywords: galectin, jelly roll, Apoptosis, Hydrolase, Nuclease
Deposited on 2008-01-23, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • initiating methionine (0)
      • engineered (33)
      • see remark 999 (132)
      • expression tag (159-166)
    Domains in SCOPe 2.07: d2zgqa1, d2zgqa2
  • Chain 'B':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • initiating methionine (0)
      • engineered (33)
      • see remark 999 (132)
      • expression tag (159-165)
    Domains in SCOPe 2.07: d2zgqb1, d2zgqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zgqA (A:)
    mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zgqB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zgqB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhh