PDB entry 2zgm

View 2zgm on RCSB PDB site
Description: Crystal structure of recombinant Agrocybe aegerita lectin,rAAL, complex with lactose
Class: Hydrolase
Keywords: galectin, jelly roll, Apoptosis, Hydrolase, Nuclease
Deposited on 2008-01-23, released 2009-01-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • initiating methionine (0)
      • see remark 999 (132)
    Domains in SCOPe 2.05: d2zgma_
  • Chain 'B':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Gene: AAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (1-158)
      • initiating methionine (0)
      • see remark 999 (132)
    Domains in SCOPe 2.05: d2zgmb_
  • Heterogens: LAT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zgmA (A:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zgmA (A:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytgla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zgmB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zgmB (B:)
    mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
    iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
    viqytkqisgltsslsynateetsifstvveavtytgla