PDB entry 2zgk

View 2zgk on RCSB PDB site
Description: Crystal structure of wildtype AAL
Class: Hydrolase
Keywords: galectin, jelly roll, Apoptosis, Hydrolase, Nuclease
Deposited on 2008-01-23, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.253
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-tumor lectin
    Species: Agrocybe aegerita [TaxId:5400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WY08 (0-157)
      • see remark 999 (131)
    Domains in SCOPe 2.08: d2zgka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zgkA (A:)
    qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
    afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv
    iqytkqisgltsslsynateetsifstvveavtytgla