PDB entry 2zgd

View 2zgd on RCSB PDB site
Description: asn-hydroxylation stabilises the ankyrin repeat domain fold
Deposited on 2008-01-21, released 2008-02-05
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3 repeat synthetic ankyrin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZGD (Start-109)
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2zgdA (A:)
gsshhhhhhssglvprgshmgsdlgkklleaaragqddevrilmangadvaakdkngstp
lhlaarnghlevvkllleagadvnaqdkfgktafdisidngnedlaeilq

    Sequence, based on observed residues (ATOM records):
    >2zgdA (A:)
hhhhhssgsdlgkklleaaragqddevrilmangadvaakdkngstplhlaarnghlevv
kllleagadvnaqdkfgktafdisidngnedlaeilq