PDB entry 2zfy

View 2zfy on RCSB PDB site
Description: Crystal structure of human Otubain 1
Class: hydrolase
Keywords: OTU, Otubain, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, Hydrolase, Immune response, Phosphoprotein, Protease, Thiol protease, Ubl conjugation pathway
Deposited on 2008-01-16, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.195
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: OTUB1, OTB1, OTU1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zfya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zfyA (A:)
    gseiavqnplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafg
    fshleallddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvad
    llasfndqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdh
    ihiialaqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfyA (A:)
    nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshleal
    lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
    qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
    qalsvsiqveymdgeggttnphifpegsepkvyllyrpghydilyk