PDB entry 2zfs

View 2zfs on RCSB PDB site
Description: Exploring trypsin S3 pocket
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase inhibitors, Digestion, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2008-01-10, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.139
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zfsa_
  • Heterogens: CA, 12U, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2zfsA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn