PDB entry 2zfc

View 2zfc on RCSB PDB site
Description: x-ray crystal structure of an engineered n-terminal hiv-1 gp41 trimer with enhanced stability and potency
Deposited on 2007-12-29, released 2008-04-22
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZFC (Start-48)
  • Chain 'B':
    Compound: hiv-1 gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZFC (Start-48)
  • Chain 'C':
    Compound: hiv-1 gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZFC (Start-48)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2zfcA (A:)
qarqlvsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik

    Sequence, based on observed residues (ATOM records):
    >2zfcA (A:)
vsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2zfcB (B:)
qarqlvsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik

    Sequence, based on observed residues (ATOM records):
    >2zfcB (B:)
vsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2zfcC (C:)
qarqlvsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik

    Sequence, based on observed residues (ATOM records):
    >2zfcC (C:)
vsglvqqqnnilraleatqhavqalvwgvkqlqarvlaleryik