PDB entry 2zfa

View 2zfa on RCSB PDB site
Description: Structure of Lactate Oxidase at pH4.5 from AEROCOCCUS VIRIDANS
Class: oxidoreductase
Keywords: L-LACTATE OXIDASE, FLAVOENZYME, FMN, D-LACTATE, OXIDOREDUCTASE, Flavoprotein
Deposited on 2007-12-26, released 2008-04-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zfaa_
  • Chain 'B':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zfab_
  • Heterogens: FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zfaA (A:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfaA (A:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdfgm
    pivqrylrgtaeygaskqkisprdieeiaghsglpvfvkgiqhpedadmaikrgasgiwv
    snhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrpv
    lfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zfaB (B:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zfaB (B:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvaskqkispr
    dieeiaghsglpvfvkgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiae
    rvnkrvpivfdsgvrrgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdl
    trvmqltgsqnvedlkgldlfdnpygyey