PDB entry 2zej

View 2zej on RCSB PDB site
Description: Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
Class: Transferase
Keywords: Parkinson's Disease, LRRK2, ROC, GTPase, ROCO, Kinase, ATP-binding, Disease mutation, GTP-binding, GTPase activation, Leucine-rich repeat, Membrane, Nucleotide-binding, Parkinson disease, Serine/threonine-protein kinase, Transferase
Deposited on 2007-12-13, released 2008-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich repeat kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LRRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zeja_
  • Chain 'B':
    Compound: Leucine-rich repeat kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LRRK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zejb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zejA (A:)
    nrmklmivgntgsgkttllqqlmktkksdlgmqsatvgidvkdwpiqirdkrkrdlvlnv
    wdfagreefysthphfmtqralylavydlskgqaevdamkpwlfnikarassspvilvgt
    hldvsdekqrkacmskitkellnkrgfpairdyhfvnateesdalaklrktiineslnfk
    irdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zejA (A:)
    mklmivgntgsgkttllqqlmktvgidvkdwpilvlnvwdfagreefysthphfmtqral
    ylavydlskgqaevdamkpwlfnikarassspvilvgthldvsdekqrkacmskitkell
    nkrgfpairdyhfvnateesdalaklrktiineslnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zejB (B:)
    nrmklmivgntgsgkttllqqlmktkksdlgmqsatvgidvkdwpiqirdkrkrdlvlnv
    wdfagreefysthphfmtqralylavydlskgqaevdamkpwlfnikarassspvilvgt
    hldvsdekqrkacmskitkellnkrgfpairdyhfvnateesdalaklrktiineslnfk
    irdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zejB (B:)
    mklmivgntgsgkttllqqlmktqsatvgidvkdwpilvlnvwdfagreefysthphfmt
    qralylavydlskgqaevdamkpwlfnikarassspvilvgthldvsdekqrkacmskit
    kellnkrgfpairdyhfvnateesdalaklrktiineslnfk