PDB entry 2zeh

View 2zeh on RCSB PDB site
Description: Crystal structure of the human glutaminyl cyclase mutant E201Q at 1.8 angstrom resolution
Class: transferase
Keywords: hydrogen bond network, glutaminyl cyclase, pyroglutamate, site-directed mutagenesis, proton transfer, Acyltransferase, Glycoprotein, Metal-binding, Transferase
Deposited on 2007-12-12, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (0-328)
      • engineered (168)
    Domains in SCOPe 2.07: d2zeha_
  • Chain 'B':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16769 (0-328)
      • engineered (168)
    Domains in SCOPe 2.07: d2zehb_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zehA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgqeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zehA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgqeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zehB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgqeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zehB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgqeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl