PDB entry 2zec

View 2zec on RCSB PDB site
Description: Potent, Nonpeptide Inhibitors of Human Mast Cell Tryptase
Class: hydrolase
Keywords: tryptase, serine protease, Hydrolase
Deposited on 2007-12-08, released 2008-12-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptase beta 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zeca_
  • Chain 'B':
    Compound: Tryptase beta 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zecb_
  • Chain 'C':
    Compound: Tryptase beta 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zecc_
  • Chain 'D':
    Compound: Tryptase beta 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2zecd_
  • Heterogens: 11N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zecA (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zecB (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zecC (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zecD (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk