PDB entry 2zdz

View 2zdz on RCSB PDB site
Description: X-ray structure of Bace-1 in complex with compound 3.b.10
Class: hydrolase
Keywords: BACE, Aspartyl Protease, Acylguanidine Inhibitor, Alternative splicing, Glycoprotein, Hydrolase, Membrane, Transmembrane, Zymogen
Deposited on 2007-12-04, released 2008-12-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2zdza_
  • Heterogens: 310, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zdzA (A:)
    etdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaap
    hpflhryyqrqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaite
    sdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqs
    evlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydk
    sivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvis
    lylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvv
    fdrarkrigfavsachvhdefrtaavegpfvtldmedcgynipqtdesthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zdzA (A:)
    sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
    styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
    ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfvlasvggsmiiggidhsl
    ytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfea
    avksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpq
    qylrpcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegp
    fvtlmedcgy