PDB entry 2zdt

View 2zdt on RCSB PDB site
Description: Crystal Structure of human JNK3 complexed with an isoquinolone inhibitor
Class: transferase
Keywords: PROTEIN KINASE, ATP-binding, Epilepsy, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2007-11-27, released 2008-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2zdta_
  • Heterogens: 46C, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zdtA (A:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zdtA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
    rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
    lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
    vddalqhpyinvwydpaeveappprehtieewkeliykevmn