PDB entry 2zdr

View 2zdr on RCSB PDB site
Description: Crystal structure of sialic acid synthase (NeuB) from neisseria meningitidis in complex with Mg2+ and (4S)-2-methyl-2,4-pentanediol
Class: lyase
Keywords: BIOSYNTHETIC PROTEIN, TIM barrel, Antifreeze-like domain, Domain-swapped dimer, LYASE
Deposited on 2007-11-27, released 2007-12-11
Made obsolete by 6ppw on 2019-10-09

The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsule biosynthesis protein
    Species: Neisseria meningitidis [TaxId:487]
    Gene: synC, siaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zdra1, d2zdra2
  • Heterogens: MG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zdrA (A:)
    mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
    demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
    qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
    hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
    mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdik
    kgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zdrA (A:)
    qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
    emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
    rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
    ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
    drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdikk
    gellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie