PDB entry 2zdp

View 2zdp on RCSB PDB site
Description: Crystal structure of IsdI in complex with Cobalt protoporphyrin IX
Class: oxidoreductase
Keywords: ruffling, beta-barrel, cobalt protoporphyrin IX, Cytoplasm, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2007-11-27, released 2008-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-degrading monooxygenase isdI
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: isdI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A827 (2-109)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2zdpa2, d2zdpa3
  • Chain 'B':
    Compound: Heme-degrading monooxygenase isdI
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: isdI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A827 (2-109)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2zdpb2, d2zdpb3
  • Heterogens: CL, COH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2zdpA (A:)
ahmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwe
sedsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2zdpB (B:)
ahmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwe
sedsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk