PDB entry 2zdn

View 2zdn on RCSB PDB site
Description: Exploring trypsin S3 pocket
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase Inhibitors, Digestion, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2007-11-26, released 2008-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cationic trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.03: d2zdna_
• Heterogens: CA, 49U, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2zdnA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn