PDB entry 2zdj

View 2zdj on RCSB PDB site
Description: Crystal Structure of TTMA177, a Hypothetical Protein from Thermus thermophilus phage TMA
Deposited on 2007-11-26, released 2008-12-02
The last revision was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTMA177
    Species: Thermus thermophilus phage TMA [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZDJ (0-68)
  • Chain 'B':
    Compound: hypothetical protein TTMA177
    Species: Thermus thermophilus phage TMA [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZDJ (0-68)
  • Chain 'C':
    Compound: hypothetical protein TTMA177
    Species: Thermus thermophilus phage TMA [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZDJ (0-68)
  • Chain 'D':
    Compound: hypothetical protein TTMA177
    Species: Thermus thermophilus phage TMA [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ZDJ (0-68)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2zdjA (A:)
mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpy
nfleayrlk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2zdjB (B:)
mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpy
nfleayrlk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2zdjC (C:)
mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpy
nfleayrlk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2zdjD (D:)
mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpy
nfleayrlk