PDB entry 2zd2

View 2zd2 on RCSB PDB site
Description: D202K mutant of P. denitrificans Atp12p
Class: chaperone
Keywords: ATPase chaperone F1 assembly, CHAPERONE
Deposited on 2007-11-19, released 2008-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP12 ATPase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_0792
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1B060
      • engineered (197)
    Domains in SCOPe 2.07: d2zd2a1
  • Chain 'B':
    Compound: ATP12 ATPase
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_0792
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1B060 (0-233)
      • engineered (197)
    Domains in SCOPe 2.07: d2zd2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zd2A (A:)
    sewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevi
    dpnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdpli
    dwaatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilgla
    virgridaptahalsrikeefqaerwgrdeeaeaqaasrlaamrdserfwhltr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zd2B (B:)
    sewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevi
    dpnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdpli
    dwaatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilgla
    virgridaptahalsrikeefqaerwgrdeeaeaqaasrlaamrdserfwhltr