PDB entry 2zd0

View 2zd0 on RCSB PDB site
Description: Crystal structures and thermostability of mutant TRAP3 A5 (ENGINEERED TRAP)
Class: RNA binding protein
Keywords: LINKER, ARTIFICIAL, ENGINEERED, RING PROTEIN, 12-mer, RNA BINDING PROTEIN
Deposited on 2007-11-15, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zd0a_
  • Chain 'B':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zd0b_
  • Chain 'C':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zd0c_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zd0A (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zd0A (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zd0B (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zd0B (B:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zd0C (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zd0C (C:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies