PDB entry 2zcz

View 2zcz on RCSB PDB site
Description: Crystal structures and thermostability of mutant TRAP3 A7 (ENGINEERED TRAP)
Class: RNA binding protein
Keywords: LINKER, ARTIFICIAL, ENGINEERED, RING PROTEIN, 12-mer, RNA-binding, Transcription, Transcription regulation, RNA BINDING PROTEIN
Deposited on 2007-11-15, released 2008-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X6J6 (Start-73)
      • linker (74-76)
    Domains in SCOPe 2.07: d2zcza_
  • Chain 'B':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zczb_
  • Chain 'C':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zczc_
  • Chain 'D':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X6J6 (Start-73)
      • linker (74-76)
    Domains in SCOPe 2.07: d2zczd_
  • Chain 'E':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zcze_
  • Chain 'F':
    Compound: transcription attenuation protein mtrb
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: MTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zczf_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zczA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczA (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegkkaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zczB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczB (B:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviese
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zczC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczC (C:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zczD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczD (D:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegkkaaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zczE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczE (E:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zczF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkkaaaaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zczF (F:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvies