PDB entry 2zcw

View 2zcw on RCSB PDB site
Description: Crystal Structure of TTHA1359, a Transcriptional Regulator, CRP/FNR family from Thermus thermophilus HB8
Class: transcription
Keywords: FNR/CRP family, transcriptional regulator, Thermus thermophilus, stationary phase, DNA-binding, Transcription regulation, Winged helix DNA-binding domain, cAMP-binding domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-11-13, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.221
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, FNR/CRP family
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zcwa1, d2zcwa2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zcwA (A:)
    mtqvretvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffg
    eealfgqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatqrlk
    nrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyirsgy
    gkiqlldlkglkelaesrgqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcwA (A:)
    etvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealf
    gqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatqrlknrmaa
    allelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyirsgygkiql
    ldlkglkelaesrg