PDB entry 2zcj

View 2zcj on RCSB PDB site
Description: Ternary structure of the Glu119Gln M.HhaI, C5-Cytosine DNA methyltransferase, with unmodified DNA and AdoHcy
Class: transferase/DNA
Keywords: Alpha and beta, 3-layer Sandwich, Methyltransferase, Restriction system, S-adenosyl-L-methionine, TRANSFERASE/DNA COMPLEX
Deposited on 2007-11-09, released 2007-12-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus parahaemolyticus [TaxId:735]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered (118)
    Domains in SCOPe 2.01: d2zcja_
  • Chain 'C':
    Compound: DNA (5'-d(*dgp*dap*dtp*dap*dgp*dcp*dgp*dcp*dtp*dap*dtp*dc)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*dtp*dgp*dap*dtp*dap*dgp*dcp*dgp*dcp*dtp*dap*dtp*dc)-3')
    Species: synthetic, synthetic
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zcjA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmqn
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.