PDB entry 2zci

View 2zci on RCSB PDB site
Description: Structure of a GTP-dependent bacterial PEP-carboxykinase from Corynebacterium glutamicum
Class: signaling protein, lyase
Keywords: GTP-dependent, carboxykinase, SIGNALING PROTEIN, LYASE
Deposited on 2007-11-09, released 2008-04-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zcia1, d2zcia2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zcib1, d2zcib2
  • Chain 'C':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zcic1, d2zcic2
  • Chain 'D':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2zcid1, d2zcid2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zciA (A:)
    mttaairglqgeaptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtli
    klneekrpnsylarsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyags
    mkgrtmyvvpfcmgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrc
    lhsvgaplepgqedvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvm
    areegwmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiaw
    lklredglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmd
    gdapahlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggr
    radtvplvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylq
    nwidmgnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvv
    ghtakaedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfda
    lkarisaaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zciA (A:)
    aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl
    arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc
    mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq
    edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareegwmaehml
    ilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklredglyavn
    pengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapahlidwmg
    ndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtvplvtqty
    dwehgtmvgallasgqvgtlrhdpmamlpfigynageylqnwidmgnkggdkmpsiflvn
    wfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldgldtpied
    vkealtapaeqwandvednaeyltflgprvpaevhsqfdalkaris
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zciB (B:)
    mttaairglqgeaptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtli
    klneekrpnsylarsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyags
    mkgrtmyvvpfcmgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrc
    lhsvgaplepgqedvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvm
    areegwmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiaw
    lklredglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmd
    gdapahlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggr
    radtvplvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylq
    nwidmgnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvv
    ghtakaedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfda
    lkarisaaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zciB (B:)
    aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl
    arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc
    mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq
    edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareegwmaehml
    ilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklredglyavn
    pengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapahlidwmg
    ndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtvplvtqty
    dwehgtmvgallasggtlrhdpmamlpfigynageylqnwidmgnkggdkmpsiflvnwf
    rrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldgldtpiedvk
    ealtapaeqwandvednaeyltflgprvpaevhsqfdalkaris
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zciC (C:)
    mttaairglqgeaptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtli
    klneekrpnsylarsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyags
    mkgrtmyvvpfcmgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrc
    lhsvgaplepgqedvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvm
    areegwmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiaw
    lklredglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmd
    gdapahlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggr
    radtvplvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylq
    nwidmgnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvv
    ghtakaedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfda
    lkarisaaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zciC (C:)
    aptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsyl
    arsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfc
    mgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgq
    edvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareegwmaehml
    ilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklredglyavn
    pengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapahlidwmg
    ndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtvplvtqty
    dwehgtmvgallasgqvgtlrhdpmamlpfigynageylqnwidmgnkggdkmpsiflvn
    wfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldgldtpied
    vkealtapaeqwandvednaeyltflgprvpaevhsqfdalkaris
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zciD (D:)
    mttaairglqgeaptknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtli
    klneekrpnsylarsnpsdvarvesrtficsekeedagptnnwappqamkdemskhyags
    mkgrtmyvvpfcmgpisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrc
    lhsvgaplepgqedvawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvm
    areegwmaehmlilklinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiaw
    lklredglyavnpengffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmd
    gdapahlidwmgndwtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggr
    radtvplvtqtydwehgtmvgallasgqtaasaeakvgtlrhdpmamlpfigynageylq
    nwidmgnkggdkmpsiflvnwfrrgedgrflwpgfgdnsrvlkwvidrieghvgadetvv
    ghtakaedldldgldtpiedvkealtapaeqwandvednaeyltflgprvpaevhsqfda
    lkarisaaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zciD (D:)
    tknkellnwiadavelfqpeavvfvdgsqaewdrmaedlveagtliklneekrpnsylar
    snpsdvarvesrtficsekeedagptnnwappqamkdemskhyagsmkgrtmyvvpfcmg
    pisdpdpklgvqltdseyvvmsmrimtrmgiealdkigangsfvrclhsvgaplepgqed
    vawpcndtkyitqfpetkeiwsygsgyggnailakkcyalriasvmareegwmaehmlil
    klinpegkayhiaaafpsacgktnlamitptipgwtaqvvgddiawlklredglyavnpe
    ngffgvapgtnyasnpiamktmepgntlftnvaltddgdiwwegmdgdapahlidwmgnd
    wtpesdenaahpnsrycvaidqspaaapefndwegvkidailfggrradtvplvtqtydw
    ehgtmvgallastlrhdpmamlpfigynageylqnwidmgnkggdkmpsiflvnwfrrge
    dgrflwpgfgdnsrvlkwvidrieghvgadetvvghtakaedldldgldiedvkealtap
    aeqwandvednaeyltflgprvpaevhsqfdalkaris