PDB entry 2zcg

View 2zcg on RCSB PDB site
Description: Structure and inhibition of orotidine 5'-phosphate decarboxylase from plasmodium falciparum
Class: lyase
Keywords: TIM barrel, Decarboxylase, Lyase, Pyrimidine biosynthesis
Deposited on 2007-11-08, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zcga_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zcgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zcgA (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcgA (A:)
    gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
    illkapdniirkseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvf
    dylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeekn
    kyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvga
    nsydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpypq
    kaaqmyydqinailkqnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zcgB (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcgB (B:)
    gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
    illkapdniikseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfd
    ylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknk
    yysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgan
    sydemnyirtyfpncyilspgigadlhktltngyhksyekilinigraitknpypqkaaq
    myydqinailkqnme