PDB entry 2zcf

View 2zcf on RCSB PDB site
Description: Mutational study on Alpha-Gln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
Class: lyase
Keywords: CYSTEINE-SULFINIC ACID, CYSTEINE-SULFENIC ACID, PHOTO-REACTIVE, NITRILE, HYDRATION, PHOTO-ACTIVATION, Iron, Lyase, Metal-binding, Oxidation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-11-08, released 2007-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-20, with a file datestamp of 2007-11-16.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.17
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis
    Gene: nthA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448
      • engineered (89)
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis
    Gene: nthB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2zcfb1
  • Heterogens: FE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zcfB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa