PDB entry 2zcb

View 2zcb on RCSB PDB site
Description: Crystal Structure of ubiquitin P37A/P38A
Class: signaling protein
Keywords: ub-fold, Cytoplasm, Nucleus, Phosphorylation, Ubl conjugation, SIGNALING PROTEIN
Deposited on 2007-11-08, released 2007-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • engineered (36-37)
    Domains in SCOPe 2.03: d2zcba_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • engineered (36-37)
    Domains in SCOPe 2.03: d2zcbb_
  • Chain 'C':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • engineered (36-37)
    Domains in SCOPe 2.03: d2zcbc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zcbA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcbA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zcbB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcbB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zcbC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zcbC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegiaadqqrlifagkqledgrtlsdyn
    iqkestlhlvlr