PDB entry 2zc0

View 2zc0 on RCSB PDB site
Description: Crystal structure of an archaeal alanine:glyoxylate aminotransferase
Class: transferase
Keywords: alanine:glyoxylate aminotransferase, archaea, Thermococcus litoralis, transferase
Deposited on 2007-10-31, released 2008-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanine glyoxylate transaminase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zc0a_
  • Chain 'B':
    Compound: Alanine glyoxylate transaminase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zc0b_
  • Chain 'C':
    Compound: Alanine glyoxylate transaminase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zc0c_
  • Chain 'D':
    Compound: Alanine glyoxylate transaminase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zc0d_
  • Heterogens: ZN, PMP, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zc0A (A:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zc0A (A:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zc0B (B:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zc0B (B:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zc0C (C:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zc0C (C:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zc0D (D:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zc0D (D:)
    mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
    vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
    pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
    iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
    vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
    legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
    vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf