PDB entry 2zbz

View 2zbz on RCSB PDB site
Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (R84A mutant) in complex with 1,25-dihydroxyvitamin D3
Class: oxidoreductase
Keywords: P450, BETA PRISM, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2007-10-30, released 2008-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-SU1
    Species: Streptomyces griseolus [TaxId:1909]
    Gene: CYP105A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18326 (Start-405)
      • engineered (83)
      • see remark 999 (307)
      • expression tag (406)
    Domains in SCOPe 2.03: d2zbza_
  • Heterogens: HEM, VDX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zbzA (A:)
    mtdtattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaa
    rkllgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrik
    gmrpeveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrl
    vqstdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistaml
    lliaghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvat
    adievegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnl
    arlelevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zbzA (A:)
    tattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkl
    lgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmr
    peveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqs
    tdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllli
    aghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadi
    evegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarl
    elevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwh