PDB entry 2zb2

View 2zb2 on RCSB PDB site
Description: Human liver glycogen phosphorylase a complexed with glcose and 5-chloro-N-[4-(1,2-dihydroxyethyl)phenyl]-1H-indole-2-carboxamide
Class: transferase
Keywords: ALLOSTERIC SITE, ALLOSTERIC BINDING, Allosteric enzyme, Carbohydrate metabolism, Disease mutation, Glycogen metabolism, Glycogen storage disease, Glycosyltransferase, Nucleotide-binding, Phosphorylation, Pyridoxal phosphate, Transferase
Deposited on 2007-10-15, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zb2a_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zb2b_
  • Heterogens: GLC, MES, PLP, A46, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zb2A (A:)
    gsmakpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalah
    tvrdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgl
    dieeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqve
    eaddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnnt
    vntmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqey
    fvvaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdie
    klpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrival
    fpkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepd
    kfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakv
    kqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkkl
    fvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvi
    patdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmridd
    vaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfady
    eayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkisls
    nesnkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zb2A (A:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfgdyiqavld
    rnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgagtvfdafpdq
    vaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlv
    ekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshav
    ngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyv
    kdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkrihe
    ykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnn
    dpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtm
    dganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffsp
    kqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfs
    sdrtikeyaqniwnveps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zb2B (B:)
    gsmakpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalah
    tvrdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgl
    dieeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqve
    eaddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnnt
    vntmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqey
    fvvaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdie
    klpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrival
    fpkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepd
    kfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakv
    kqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkkl
    fvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvi
    patdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmridd
    vaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfady
    eayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkisls
    nesnkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zb2B (B:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapngdyiqavldrn
    laenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkastvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnveps