PDB entry 2zad

View 2zad on RCSB PDB site
Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8
Class: isomerase
Keywords: Muconate lactonizing enzyme (MLE), TM0006, Isomerase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-10-03, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zada1, d2zada2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zadb1, d2zadb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zadc1, d2zadc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2zadd1, d2zadd2
  • Heterogens: MN, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zadA (A:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zadA (A:)
    srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
    allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
    lggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtr
    gakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaad
    esartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgin
    qsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zadB (B:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zadB (B:)
    srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
    allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
    lggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtr
    gakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaad
    esartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgin
    qsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zadC (C:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zadC (C:)
    srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
    allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
    lggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtr
    gakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaad
    esartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgin
    qsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zadD (D:)
    msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerv
    eallaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcy
    llggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvt
    rgakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaa
    desartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgi
    nqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zadD (D:)
    srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve
    allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl
    lggkrdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtr
    gakyivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaad
    esartkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslgin
    qsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq