PDB entry 2zab

View 2zab on RCSB PDB site
Description: Crystal Structure of Family 7 Alginate Lyase A1-II' Y284F in Cmplex with Product (GGG)
Class: lyase
Keywords: alginate lyase, polysaccharide lyase family 7, y284f, complex, lyase
Deposited on 2007-10-02, released 2008-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.162
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Sphingomonas sp. [TaxId:90322]
    Gene: ALY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75WP3
      • engineered (203)
    Domains in SCOPe 2.05: d2zaba_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zabA (A:)
    paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
    nssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtna
    pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
    rsvdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zabA (A:)
    aaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggttan
    ssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtnap
    plvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdtr
    svdfvgkdagwknlkyyfkagnfvqdntstggsaiaklyslsvshs