PDB entry 2za9

View 2za9 on RCSB PDB site
Description: Crystal Structure of Alginate lyase A1-II' N141C/N199C
Class: lyase
Keywords: alginate lyase, polysaccharide lyase family 7, n141c/n199c, lyase
Deposited on 2007-10-02, released 2008-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Sphingomonas sp.
    Gene: ALY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75WP3 (0-End)
      • engineered (60)
      • engineered (118)
    Domains in SCOPe 2.06: d2za9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2za9A (A:)
    paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
    cssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtca
    pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
    rsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za9A (A:)
    paaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtta
    cssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtca
    pplvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdt
    rsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshs