PDB entry 2za8

View 2za8 on RCSB PDB site
Description: recombinant horse L-chain apoferritin N-terminal deletion mutant (residues 1-8)
Class: metal binding protein
Keywords: ferric iron binding, Acetylation, Iron storage, Metal-binding, METAL BINDING PROTEIN
Deposited on 2007-10-02, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.221
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791 (0-End)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d2za8a_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2za8A (A:)
    ysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregaerllk
    mqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadphlcd
    fleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za8A (A:)
    ysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregaerllk
    mqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadphlcd
    fleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk