PDB entry 2za4

View 2za4 on RCSB PDB site
Description: Crystal Structural Analysis of Barnase-barstar Complex
Class: Hydrolase/Hydrolase Inhibitor
Keywords: protein-protein complex, Endonuclease, Genetically modified food, Hydrolase, Nuclease, Secreted, Cytoplasm, Hydrolase/Hydrolase Inhibitor COMPLEX
Deposited on 2007-10-01, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.199
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (97)
    Domains in SCOPe 2.07: d2za4a_
  • Chain 'B':
    Compound: barstar
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (0-89)
      • engineered (39-40)
      • engineered (82)
    Domains in SCOPe 2.07: d2za4b_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (97)
    Domains in SCOPe 2.07: d2za4c_
  • Chain 'D':
    Compound: barstar
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (0-89)
      • engineered (39-40)
      • engineered (82)
    Domains in SCOPe 2.07: d2za4d_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2za4A (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliyattdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za4A (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliyattdhyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2za4B (B:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za4B (B:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfeqs
    kqltngaesvlqvfreakaegaditiils
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2za4C (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliyattdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za4C (C:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliyattdhyqtftkir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2za4D (D:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za4D (D:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwaaltgwveyplvlewrqfqln
    gaesvlqvfreakaegaditiils