PDB entry 2za2

View 2za2 on RCSB PDB site
Description: Crystal Structure of the apo-form of orotidine-5'-monophosphate decarboxylase from P.falciparum
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase, Plasmodium falciparum, Lyase, Pyrimidine biosynthesis
Deposited on 2007-09-26, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2za2a_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2za2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2za2A (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za2A (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdnkseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfdy
    lyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknky
    ysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgans
    ydemnyirtyfpncyilspgigktltngyhksyekilinigraitknpypqkaaqmyydq
    inailk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2za2B (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2za2B (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvf
    dylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeekn
    kyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvga
    nsydemnyirtyfpncyilspgiglhktltngyhksyekilinigraitknpypqkaaqm
    yydqinailk