PDB entry 2z9m

View 2z9m on RCSB PDB site
Description: Crystal structure of YycF DNA-binding domain from Staphylococcus aureus
Class: transcription
Keywords: two-component system, YycG, response regulator, helix-turn-helix motif, DNA-binding domain, Phosphorylation, Transcription, Transcription regulation, Two-component regulatory system
Deposited on 2007-09-21, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-20, with a file datestamp of 2009-01-16.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.235
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulator YycF
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9ma_
  • Chain 'B':
    Compound: response regulator YycF
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9mb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z9mA (A:)
    mqpaqdtgnvtneitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtreh
    llqtvwgydyfgdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9mA (A:)
    neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
    gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z9mB (B:)
    mqpaqdtgnvtneitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtreh
    llqtvwgydyfgdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9mB (B:)
    neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
    gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh