PDB entry 2z9i

View 2z9i on RCSB PDB site
Description: Crystal structure of RV0983 from Mycobacterium tuberculosis- Proteolytically active form
Class: Hydrolase
Keywords: SERINE PROTEASE, HtrA, Hydrolase
Deposited on 2007-09-20, released 2008-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable serine protease pepd
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9ia1, d2z9ia2
  • Chain 'B':
    Compound: probable serine protease pepd
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9ib1, d2z9ib2
  • Chain 'C':
    Compound: probable serine protease pepd
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z9ic1, d2z9ic2
  • Chain 'D':
    Compound: sveqv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (Start-4)
  • Chain 'E':
    Compound: sveqv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (Start-4)
  • Chain 'F':
    Compound: sveqv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (0-4)
  • Chain 'G':
    Compound: gatv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (0-3)
  • Chain 'H':
    Compound: gatv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (Start-3)
  • Chain 'I':
    Compound: gatv
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z9I (Start-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z9iA (A:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9iA (A:)
    gsveqvaakvvpsvvmletdleegsgiilsaegliltnnhviaaaakppkttvtfsdgrt
    apftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgiv
    salnrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlqsgsiglgfaip
    vdqakriadelistgkashaslgvqvtndktlgakivevvaggaaanagvpkgvvvtkvd
    drpinsadalvaavrskapgatvaltfqdpsggsrtvqvtlgka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z9iB (B:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9iB (B:)
    ppgsveqvaakvvpsvvmletdseegsgiilsaegliltnnhviaaaapkttvtfsdgrt
    apftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtvttgiv
    salnrpvstntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlqsgsiglgfaip
    vdqakriadelistgkashaslgvqvtndgakivevvaaanagvpkgvvvtkvddrpins
    adalvaavrskapgatvaltvqvtlgkae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z9iC (C:)
    anmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakpplg
    spppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlai
    gsplglegtvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaql
    vgvnsaiatlgadsadaqsgsiglgfaipvdqakriadelistgkashaslgvqvtndkd
    tlgakivevvaggaaanagvpkgvvvtkvddrpinsadalvaavrskapgatvaltfqdp
    sggsrtvqvtlgkaeqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9iC (C:)
    gsveqvaakvvpsvvmletdseegsgiilsaegliltnnhviaaaakpplgpppkttvtf
    sdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplglegtv
    ttgivsalnrpvstqntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlsgsigl
    gfaipvdqakriadelistgkashaslgvqvtnlgakivevgaavpkgvvvtkvdrpins
    adalvaavrskapgatlgka
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.