PDB entry 2z9g

View 2z9g on RCSB PDB site
Description: Complex structure of SARS-CoV 3C-like protease with PMA
Class: hydrolase
Keywords: complex, ATP-binding, Cytoplasm, Endonuclease, Exonuclease, Helicase, Hydrolase, Membrane, Metal-binding, Nuclease, Nucleotide-binding, Nucleotidyltransferase, Protease, Ribosomal frameshift, RNA replication, RNA-binding, RNA-directed RNA polymerase, Thiol protease, Transferase, Transmembrane, Zinc, Zinc-finger
Deposited on 2007-09-19, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 3C-like proteinase
  Species: SARS coronavirus [TaxId:227859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59641 (0-305)
  Domains in SCOPe 2.08: d2z9ga_
• Heterogens: HG, BNZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z9gA (A:)
  sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
  ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
  spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
  fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
  pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
  sgvtfq