PDB entry 2z9d

View 2z9d on RCSB PDB site
Description: The crystal structure of AzoR (azoreductase) from Escherichia coli: Oxidized AzoR in orthorhombic crystals
Class: oxidoreductase
Keywords: azoreductase, Flavoprotein, FMN, NAD, Oxidoreductase
Deposited on 2007-09-18, released 2008-03-11
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-03, with a file datestamp of 2008-05-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADH-azoreductase
    Species: Escherichia coli [TaxId:562]
    Gene: azoR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z9da1
  • Chain 'B':
    Compound: FMN-dependent NADH-azoreductase
    Species: Escherichia coli [TaxId:562]
    Gene: azoR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z9db1
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z9dA (A:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
    sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
    tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
    emaakaqsdakaaidsivsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z9dB (B:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
    sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
    tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
    emaakaqsdakaaidsivsa