PDB entry 2z9b

View 2z9b on RCSB PDB site
Description: The crystal structure of AzoR (azoreductase) from Escherichia coli: Reduced AzoR in tetragonal crystals
Class: Oxidoreductase
Keywords: azoreductase, Flavoprotein, FMN, NAD, Oxidoreductase
Deposited on 2007-09-18, released 2008-03-11
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-03, with a file datestamp of 2008-05-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADH-azoreductase
    Species: Escherichia coli [TaxId:562]
    Gene: azoR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z9ba1
  • Heterogens: FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z9bA (A:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
    sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
    tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
    emaakaqsdakaaidsivsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z9bA (A:)
    skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgaltp
    rqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfrytengpeg
    lvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygpemaakaq
    sdakaaidsivsa