PDB entry 2z95

View 2z95 on RCSB PDB site
Description: Crystal Structure of GDP-D-Mannose Dehydratase from Aquifex aeolicus VF5
Class: lyase
Keywords: SHORT-CHAIN DEHYDROGENASE/REDUCTASE, LYASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-09-18, released 2008-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-D-mannose dehydratase
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: rfbD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z95a_
  • Chain 'B':
    Compound: GDP-D-mannose dehydratase
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: rfbD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z95b_
  • Chain 'C':
    Compound: GDP-D-mannose dehydratase
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: rfbD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z95c_
  • Chain 'D':
    Compound: GDP-D-mannose dehydratase
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: rfbD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z95d_
  • Heterogens: NDP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z95A (A:)
    msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmd
    llefsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdt
    kfyqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfn
    hesplrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpep
    ddyviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpae
    vdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z95A (A:)
    gkralitgirgqdgaylaklllekgyevygadraswrlkelgiendvkiihmdllefsni
    irtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkfyqast
    semfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhesplrg
    iefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpepddyviat
    gethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpaevdilvgn
    pekamkklgwkprttfdelveimmeadlkrvrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z95B (B:)
    msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmd
    llefsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdt
    kfyqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfn
    hesplrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpep
    ddyviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpae
    vdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z95B (B:)
    gkralitgirgqdgaylaklllekgyevygadaswrlkelgiendvkiihmdllefsnii
    rtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkfyqasts
    emfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhesplrgi
    efvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpepddyviatg
    ethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpaevdilvgnp
    ekamkklgwkprttfdelveimmeadlkrvrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z95C (C:)
    msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmd
    llefsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdt
    kfyqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfn
    hesplrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpep
    ddyviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpae
    vdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z95C (C:)
    gkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmdll
    efsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkf
    yqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhe
    splrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpepdd
    yviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpaevd
    ilvgnpekamkklgwkprttfdelveimmeadlkrvrd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z95D (D:)
    msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmd
    llefsniirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdt
    kfyqastsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfn
    hesplrgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpep
    ddyviatgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpae
    vdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z95D (D:)
    gkralitgirgqdgaylaklllekgyevygadgefaswrlkelgiendvkiihmdllefs
    niirtiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkfyqa
    stsemfgkvqeipqtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhespl
    rgiefvtrkityslarikyglqdklvlgnlnakrdwgyapeyveamwlmmqqpepddyvi
    atgethtvrefvekaakiagfdiewvgeginekgidrntgkvivevseeffrpaevdilv
    gnpekamkklgwkprttfdelveimmeadlkr