PDB entry 2z93

View 2z93 on RCSB PDB site
Description: Crystal structure of Fab fragment of anti-ciguatoxin antibody 10C9 in complex with CTX3C-ABCD
Class: immune system
Keywords: Immunogloburin like fold, IMMUNE SYSTEM
Deposited on 2007-09-14, released 2008-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.297
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-ciguatoxin antibody 10C9 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z93
    Domains in SCOPe 2.06: d2z93a1
  • Chain 'B':
    Compound: Anti-ciguatoxin antibody 10C9 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z93
  • Chain 'C':
    Compound: Anti-ciguatoxin antibody 10C9 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z93 (0-End)
    Domains in SCOPe 2.06: d2z93c1
  • Chain 'D':
    Compound: Anti-ciguatoxin antibody 10C9 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z93 (0-End)
    Domains in SCOPe 2.06: d2z93d1, d2z93d2
  • Heterogens: END, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z93A (A:)
    qllesgpdlvkpsqslsltctvtgysitsgynwhwirqfpgnklewmgyihyrgttnynt
    slksrisitrdssknqfflqlnsvttedtatyycacddfysdywgqgtivtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z93A (A:)
    ttppsvyplapgsavtlgclvkgyfpepvtvtwnsgvhtfpavlqsdlytlsssvtvpse
    tvtcnvahpasstkvdkkivp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z93C (C:)
    qllesgpdlvkpsqslsltctvtgysitsgynwhwirqfpgnklewmgyihyrgttnynt
    slksrisitrdssknqfflqlnsvttedtatyycacddfysdywgqgtivtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z93C (C:)
    qllesgpdlvkpsqslsltctvtgysitsgynwhwirqfpgnklewmgyihyrgttnynt
    slksrisitrdssknqfflqlnsvttedtatyycacddfysdywgqgtivtvssakttpp
    svyplaptlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvtwpset
    vtcnvahpasstkvdkkivpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z93D (D:)
    elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z93D (D:)
    elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr
    fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkngvlnswtdqdskdstysmsstltceathkts
    tspi