PDB entry 2z8l

View 2z8l on RCSB PDB site
Description: Crystal Structure of the Staphylococcal superantigen-like protein SSL5 at pH 4.6 complexed with sialyl Lewis X
Class: sugar binding protein
Keywords: OB fold, B-grasp, SUGAR BINDING PROTEIN
Deposited on 2007-09-06, released 2007-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exotoxin 3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ssl5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFS6 (Start-207)
      • see remark 999 (26)
      • see remark 999 (52-53)
      • see remark 999 (68)
      • see remark 999 (70)
      • see remark 999 (92)
      • see remark 999 (110)
      • see remark 999 (113)
      • see remark 999 (121)
      • see remark 999 (125-126)
      • see remark 999 (131)
      • see remark 999 (138)
      • see remark 999 (154)
      • see remark 999 (164)
      • see remark 999 (170)
      • see remark 999 (187-188)
      • see remark 999 (202)
    Domains in SCOPe 2.03: d2z8la1, d2z8la2
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z8lA (A:)
    gpgssehkakyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriq
    ifgkdierlktrknpgldifvvkeaenrngtvfsyggvtkknqgayydylnapkfvikke
    vdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytf
    elnkklqphrmsdvidgrniekmeanir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z8lA (A:)
    difdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdierlktrknpg
    ldifvvkeaenrngtvfsyggvtkknqgayydylnapkfvikkevdagvythvkrhyiyk
    eevslkeldfklrqyliqnfdlykkfpkdskikvimkdggyytfelnkklqphrmsdvid
    grniekmeanir