PDB entry 2z8g

View 2z8g on RCSB PDB site
Description: Aspergillus niger ATCC9642 isopullulanase complexed with isopanose
Class: hydrolase
Keywords: isopullulanase, GH49, dextranase, pullulan, beta-helix, Glycoprotein, Glycosidase, Hydrolase, Secreted
Deposited on 2007-09-05, released 2007-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2z8ga1, d2z8ga2, d2z8ga3
  • Chain 'B':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2z8gb1, d2z8gb2, d2z8gb3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z8gA (A:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z8gB (B:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid