PDB entry 2z8c

View 2z8c on RCSB PDB site
Description: Phosphorylated insulin receptor tyrosine kinase in complex with (4-{[5-carbamoyl-4-(3-methylanilino)pyrimidin-2-yl]amino}phenyl)acetic acid
Class: transferase
Keywords: TRANSFERASE, Alternative splicing, ATP-binding, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphorylation, Polymorphism, Receptor, Transmembrane, Tyrosine-protein kinase, Transducer
Deposited on 2007-09-05, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-302)
      • engineered (3)
    Domains in SCOPe 2.07: d2z8ca1
  • Chain 'B':
    Compound: 6-mer peptide from Insulin receptor substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IRS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: S91

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z8cA (A:)
    ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
    rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
    rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
    dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
    fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
    enk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z8cA (A:)
    fvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
    flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
    ptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyy
    rkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvm
    dggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'B':
    No sequence available.