PDB entry 2z83

View 2z83 on RCSB PDB site
Description: Crystal Structure of Catalytic Domain of Japanese Encephalitis Virus NS3 Helicase/Nucleoside Triphosphatase at a Resolution 1.8
Class: viral protein
Keywords: HELICASE, Hydrolase, Membrane, Nucleotide-binding, RNA replication, Transmembrane, VIRAL PROTEIN
Deposited on 2007-08-30, released 2008-03-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase/Nucleoside Triphosphatase
    Species: Japanese encephalitis virus [TaxId:11072]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z83a1, d2z83a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z83A (A:)
    masmtggqqmgrgspnmlrkrqmtvldlhpgsgktrkilpqiikdaiqqrlrtavlaptr
    vvaaemaealrglpvryqtsavqrehqgneivdvmchatlthrlmspnrvpnynlfvmde
    ahftdpasiaargyiatkvelgeaaaifmtatppgttdpfpdsnapihdlqdeipdraws
    sgyewiteyagktvwfvasvkmgneiamclqragkkviqlnrksydteypkckngdwdfv
    ittdisemganfgasrvidcrksvkptileegegrvilgnpspitsasaaqrrgrvgrnp
    nqvgdeyhyggatseddsnlahwteakimldnihmpnglvaqlygperekaftmdgeyrl
    rgeekknflellrtadlpvwlaykvasngiqytdrkwcfdgprtnailednieveivtrm
    gerkilkprwldarvyadhqalkwfkdfaagkrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z83A (A:)
    pnmlrkrqmtvldlhpgsgktrkilpqiikdaiqqrlrtavlaptrvvaaemaealrglp
    vryqtgneivdvmchatlthrlmspnvpnynlfvmdeahftdpasiaargyiatkvelge
    aaaifmtatppgttdpfpdsnapihdlqdeipdrawssgyewiteyagktvwfvasvkmg
    neiamclqragkkviqlnrksydteypkckngdwdfvittdisanfgasrvidcrksvkp
    tileegegrvilgnpspitsasaaqrrgrvgrnpnqvgdeyhyggatseddsnlahwtea
    kimldnihmpnglvaqlygperekaftmdgeyrlrgeekknflellrtadlpvwlaykva
    sngiqytdrkwcfdgprtnailednieveivtrmgerkilkprwldarvyadhqalkwfk
    dfaagk