PDB entry 2z7y

View 2z7y on RCSB PDB site
Description: Crystal Structure of H2O2 treated Cu,Zn-SOD
Class: oxidoreductase
Keywords: metalloprotein, dismutase, hydrogen peroxide, Acetylation, Antioxidant, Copper, Cytoplasm, Metal-binding, Oxidoreductase, Zinc
Deposited on 2007-08-30, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7ya_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z7yb_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z7yA (A:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z7yB (B:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak