PDB entry 2z7g

View 2z7g on RCSB PDB site
Description: Crystal structure of adenosine deaminase ligated with EHNA
Class: hydrolase
Keywords: beta barrel, protein-inhibitor complex, Acetylation, Hydrolase, Nucleotide metabolism, Pharmaceutical, Polymorphism
Deposited on 2007-08-20, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.21
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • see remark 999 (197)
      • see remark 999 (244)
      • see remark 999 (350)
    Domains in SCOPe 2.08: d2z7ga_
  • Heterogens: ZN, EH9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z7gA (A:)
    aqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdf
    lakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqae
    gdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaid
    lagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyh
    tledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifk
    stldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z7gA (A:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr